PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID 462852836
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Chloridoideae; Eragrostideae; Eragrostidinae; Eragrostis
Family TALE
Protein Properties Length: 736aa    MW: 82291.8 Da    PI: 6.2404
Description TALE family protein
Gene Model
Gene Model ID Type Source Coding Sequence
462852836genomeTefView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox27.26.7e-094735101954
                HHH..SSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHH CS
   Homeobox  19 Fek..nrypsaeereeLAkklgLterqVkvWFqNrRak 54 
                Fe   ++yp+ +e+  LA+++gLt +q+++WF N R +
  462852836 473 FEHflHPYPKDSEKLMLARQTGLTRSQISNWFINARVR 510
                664559******************************88 PP

2BELL118.43.2e-38265336172
       BELL   1 erqelqkkkakLlslleeVdkrYkqyveqlqtvissFeavaglgsakpYtslAlkaiSrhFrcLkdaiaeqi 72 
                e+qelq+k akL+ +l+eVd++Yk+y++q+q v++sF++vag g+akpYt++Al++iSrhFrcLkdai +qi
  462852836 265 EKQELQNKVAKLMAMLDEVDRKYKHYYHQMQLVVASFDMVAGSGAAKPYTAVALQTISRHFRCLKDAINDQI 336
                689*******************************************************************98 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM005741.3E-54189334IPR006563POX domain
PfamPF075263.3E-50195332IPR006563POX domain
Gene3DG3DSA:1.10.10.606.8E-4382412IPR009057Homeodomain-like
PROSITE profilePS5007112.357451514IPR001356Homeobox domain
Gene3DG3DSA:1.10.10.604.5E-28453523IPR009057Homeodomain-like
SMARTSM003891.6E-9454518IPR001356Homeobox domain
CDDcd000865.88E-12454515No hitNo description
SuperFamilySSF466893.85E-17455520IPR009057Homeodomain-like
PfamPF059201.2E-17471510IPR008422Homeobox KN domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 736 aa     Download sequence    Send to blast
MATYYSSPGS ERDSQTMYSA ESGDVSYPMP SALGNMLYPN NASAGPYTEF SGIIQHQQNF  60
MELSGHPSSV PHDSSSKEST NMVTSLAEQR SFGPLKDVRN EMLMHLMDGA QSSGSNLIHN  120
DSHNSVQLDF GMLNNHNSTS VPSAPGQGLS LSLNTHILAP SYPYWSVKPD LLAPHSYQGD  180
DDRIKNMQSE ASQAIRNSRY LKAAQELLDE IVSVWKSVKR KEDKGHAEVG KADVKETEGG  240
TNSEGVSSNP QESGANAAAE LSTAEKQELQ NKVAKLMAML DEVDRKYKHY YHQMQLVVAS  300
FDMVAGSGAA KPYTAVALQT ISRHFRCLKD AINDQISIIR KKLGEEDNTS GKEGRLTRLR  360
YIDQQLRQQR AFQQYGMLQQ NAWRPQRGLP ENSVSILRAW LFEHFLHPII RKKLGEEENT  420
SGKEGRLTRL RYIDQQLRQQ RAFQQYGMLQ QNAWRPQRGL PENSVSILRA WLFEHFLHPY  480
PKDSEKLMLA RQTGLTRSQI SNWFINARVR LWKPMIEDMY KEEIGEAELD SNSSSDNVSR  540
SKIKVPSFDE KEDLKSSTSQ PCQTSQLGES KANISMMSLS GPPACFNNEA NPDDSFMNLM  600
LKDQRPGEMD GSLLHDAVAH HSDDSARFMA YHLAELGRYG NNTVSLTLGL QHAENSLSVP  660
NTQQTFASVG HEDIYNVTAP LSGAPASSDY ESTNQIDQEQ RITCPVKHGI VVLVAIGTEE  720
EGCDSLFPKS EQETKR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
3k2a_A5e-16460517562Homeobox protein Meis2
3k2a_B5e-16460517562Homeobox protein Meis2
4xrs_A3e-16460517158Homeobox protein Meis1
4xrs_B3e-16460517158Homeobox protein Meis1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004982177.10.0PREDICTED: BEL1-like homeodomain protein 7
RefseqXP_004982178.10.0PREDICTED: BEL1-like homeodomain protein 7
SwissprotQ9SIW12e-76BLH7_ARATH; BEL1-like homeodomain protein 7
TrEMBLC0PDQ80.0C0PDQ8_MAIZE; Uncharacterized protein
TrEMBLK4A6U70.0K4A6U7_SETIT; Uncharacterized protein
STRINGSi034602m0.0(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP90138131
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G34610.22e-71BEL1-like homeodomain 6